In humans and mice, loss of HOXA13 function causes defects in the growth and patterning of the digits and interdigital tissues. Analysis of Hoxa13 expression reveals a pattern of localization overlapping with sites of reduced Bmp2 and Bmp7 expression in Hoxa13mutant limbs. Biochemical analyses identified a novel series of Bmp2and Bmp7 enhancer regions that directly interact with the HOXA13 DNA-binding domain and activate gene expression in the presence of HOXA13. Immunoprecipitation of HOXA13-Bmp2 and HOXA13-Bmp7 enhancer complexes from the developing autopod confirm that endogenous HOXA13 associates with these regions. Exogenous application of BMP2 or BMP7 partially rescues the Hoxa13 mutant limb phenotype, suggesting that decreased BMP signaling contributes to the malformations present in these tissues. Together, these results provide conclusive evidence that HOXA13 regulates Bmp2 and Bmp7 expression, providing a mechanistic link between HOXA13, its target genes and the specific developmental processes affected by loss of HOXA13 function.
Introduction
The analysis of limb development has yielded remarkable insights into the molecular and genetic mechanisms required to form a functional three-dimensional structure. In mice, initiation of the forelimb buds occurs at embryonic day (E) 9.0 as a small outgrowth of the lateral plate mesoderm at the junction of the caudal and thoracic somites(Tickle et al., 1976; Solursh et al., 1990; Kaufman and Bard, 1999). Following induction, limb bud growth and expansion continues under the influence of signals emanating from the three primary limb axes, including:FGFs to maintain proliferation in the proximodistal axis; sonic hedgehog,which establishes the zone of polarizing activity in the anteroposterior axis;and Wnt7a and En1, which specify the dorsoventral polarity of the developing limb (Riddle et al.,1993; Parr and McMahon,1995; Chiang et al.,1996; Crossley et al.,1996; Ohuchi et al.,1997; Loomis et al.,1998; Min et al.,1998; Sekine et al.,1999; Lewandoski et al.,2000; Moon and Capecchi,2000).
Although many of the genes required for normal limb development have been identified (for reviews, see Niswander,2003; Mariani and Martin,2003; Logan, 2003; Gurrieri et al., 2002; Tickle, 2003), surprisingly little is known about how these genes are transcriptionally regulated. Among the factors likely to regulate the expression of limb patterning genes are the 5′ HOX transcription factors, whose loss-of-function phenotypes demonstrate their capacity to regulate key developmental processes such as cell adhesion, apoptosis, proliferation and migration (Dollé et al.,1989; Davis and Capecchi, 1994; Davis et al., 1995; Fromental-Ramain et al.,1996a; Fromental-Ramain et al., 1996b; Stadler et al.,2001; Wellik and Capecchi,2003; Boulet and Capecchi,2004; Spitz et al.,2003; Kmita et al.,2002). Although it is clear that HOX proteins mediate many of the cellular events during limb morphogenesis, the mechanistic links between these transcription factors, their target genes, and their effects on specific cellular processes are still largely unknown(Stadler et al., 2001; Morgan et al., 2003; Wellik and Capecchi, 2003; Boulet and Capecchi, 2004). One reason for this is that HOX proteins may not regulate the global expression of any particular target gene, but instead control the development of specific tissues through direct interactions with tissue-specific gene regulatory elements (Hombría and Lovegrove,2003; Grenier and Carroll,2000; Weatherbee et al.,1998).
In the developing limb, HOXA13 localizes to discrete domains within the interdigital and interarticular regions, where its function is required for interdigital programmed cell death (IPCD), digit outgrowth and chondrogenesis(Stadler et al., 2001; Fromental-Ramain et al.,1996a). This observation led us to hypothesize that HOXA13 directly regulates genes whose products are necessary for IPCD and joint formation. Testing this hypothesis, we detected changes in the expression of the genes encoding bone morphogenetic proteins 2 and 7 (Bmp2, Bmp7)in the interdigital and distal joint tissues, suggesting that HOXA13 may directly regulate their expression in these discrete regions. Scanning the DNA sequences upstream of Bmp2 and Bmp7, we identified a series of nucleotide sequences preferentially bound by the HOXA13 DNA-binding domain(A13-DBD). In vitro characterization of these DNA sequences revealed they function as enhancer elements that, in the presence of HOXA13, activate the expression of reporter constructs, independent of sequence orientation. Furthermore, in the developing autopod, endogenous HOXA13 binds these same enhancer elements, which can be immunoprecipitated with a HOXA13-specific antibody. In Hoxa13 mutant limbs, both IPCD and Msx2expression are partially restored with exogenous BMP2 or BMP7 treatment,suggesting that HOXA13 is required for sufficient levels of BMP2 and BMP7 to be expressed in the interdigital tissues, as well as for these tissues to fully respond to BMP signaling. Together, these results provide the first molecular evidence that HOXA13 controls distal limb morphogenesis through the direct regulation of Bmp2 and Bmp7 expression, whose combined functions are necessary for normal digit morphogenesis and IPCD.
Materials and methods
Mouse strains
Hoxa13 homozygous mutant mice were produced by heterozygous mutant intercrosses, using the previously described Hoxa13GFPmutant allele and genotyping procedures(Stadler et al., 2001). Bmp7 mutant embryos were produced by intercrosses of heterozygous mutant Bmp7 mice (Jackson Laboratories, Bar Harbor, ME). The Bmp7 mutant allele was originally described by Luo et al.(Luo et al., 1995). Embryo genotypes were determined by using PCR with primers specific for the PGK-HPRT disruption present in the mutant Bmp7 allele and with DNA derived from the embryo yolk sac. All care and analysis of Hoxa13GFP and Bmp7 mice was carried out in accordance with an approved mouse handling protocol.
RNA in situ hybridization and immunohistochemistry
Antisense riboprobes specific for Bmp2, Bmp4 and Bmp7were generated using plasmids kindly provided by B. Hogan (Bmp2 and Bmp4; Duke University, NC) and R. Beddington (Bmp7; NIMR,London), whereas Hoxa13, Msx2, and BMP-receptor IA, IB and II riboprobes were produced as described(Morgan et al., 2003). Whole mount in situ hybridization, immunohistochemistry and confocal imaging of limb frozen sections were performed as described by Manley and Capecchi, and by Morgan et al. (Manley and Capecchi,1995; Morgan et al.,2003). Antibodies to BMP2/4 (AF355) and BMP7 (AF354) were purchased from R&D Systems, and were used at 0.02 μg/ml on frozen limb sections.
Analysis of programmed cell death
TUNEL analysis was performed as described by Stadler et al.(Stadler et al., 2001). Limbs from E13.5 Hoxa13 and Bmp7 wild-type, heterozygous- and homozygous-mutant embryos were examined using a Bio-Rad MRC 1024 confocal laser imaging system fitted with a Leica DMRB microscope. Images were produced by compiling z-series scans of the intact limb buds, typically averaging 40-50 sections at 1 μm per section. Kalman Digital Noise reduction was used for all samples.
Limb organ culture and BMP supplementation
Affi-gel blue beads (Bio-Rad) washed five times in sterile PBS were incubated at 4°C overnight in solutions containing 0.1 mg/ml of rhBMP2(R&D Systems) or rhBMP7 (R&D Systems), or in sterile PBS. Beads were inserted into the interdigital mesenchyme of E13.5 wild-type, heterozygous-and homozygous-mutant limbs between digits II and III, and III and IV. Limb explants containing the beads were placed on 0.4 μm HTTP Isopore membrane filters (Millipore), coated with gelatin in 60 mm organ culture dishes(Falcon), and grown in BGJb media (Invitrogen), supplemented with 50% rat whole-embryo culture serum (Harlan Bioproducts), 50 U/ml penicillin and 50μg/ml streptomycin, for 8 hours in an incubator at 37°C, 10%CO2. The limb explants were examined for induced Msx2expression or for changes in programmed cell death, using TUNEL analysis of frozen sections as described (Morgan et al., 2003).
Synthesis and structural characterization of the HOXA13 DNA-binding domain
Protein synthesis and purification
The 67 amino acid HOXA13 DNA-binding domain (A13-DBD)(GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSER QVTIWFQNRRVKEKKVINKLKTTS) was synthesized on an ABI 443A peptide synthesizer (Applied Biosystems, Foster City, CA), using Fmoc-Ser(tBu)-PEG-PS resin (PerSeptive Biosystems, 0.16 mmol/g) and Fmoc amino acids (Anaspec). After synthesis, the peptide was purified to greater than 95% purity, using a Gilson Model 321 High Performance Liquid Chromatography (HPLC) system fitted with a semi-preparative reversed-phase peptide column (Grace Vydac, C18, 15 μm, 300 Å,250×25 mm). The mass and purity of the A13-DBD peptide was verified using a Micromass time-of-flight mass spectrometer (Q-tof micro, Waters,Manchester, UK), peptide sequencing and amino acid analysis.
Circular dichroism spectroscopy
The thermal stability and folding of the A13-DBD peptide into a helix-turn-helix DNA-binding motif was verified by circular dichroism (CD). The A13-DBD peptide was reconstituted to a final concentration of 100 μM in 50 mM NaF (buffered to pH 7.2 with phosphate buffer). CD spectra were obtained using an Aviv 202 spectropolarimeter and a 0.1 mm path length rectangular cell(Hellma, Müllheim, Germany). The wavelength spectra represent at least an average of 10 scans with 0.1 nm wavelength steps. Thermal transitions were recorded at a heating rate of 10°C/hour in a 1 mm cell.
DNA-binding site identification with the HOXA13 DNA-binding domain
The A13-DBD peptide was solubilized to a concentration of 500 nM in PBS,and incubated with radioactively labeled Bmp2 and Bmp7upstream regions (200-300 base pair fragments) at 4°C in gel shift buffer(Promega). 5′ upstream sequences for Bmp2 and Bmp7,representing nucleotides –600 to +1 for Bmp2 (Ensembl ref:ENSMUSG00000027358), and –3113 to +1 for Bmp7 (Ensembl ref:ENSMUSG00000008999), were examined for binding by the A13-DBD peptide, using electrophoretic mobility shift assays (EMSA) on a 4% non-denaturing polyacrylamide gel buffered with 0.5×TBE. PCR fragments exhibiting reduced electrophoretic mobility in the presence of the A13-DBD peptide were subdivided into 30-50 base-pair (bp) regions and synthesized as self-annealing oligonucleotides (Oligos Etc, Wilsonville, OR) to narrow the regions bound by HOXA13. Double-stranded oligonucleotides were prepared by heating 1 μM oligonucleotide stock solutions in 50 mM Tris-HCl (pH 7.2), 50 mM NaCl to 95°C for 5 minutes and allowing them to cool to room temperature. Annealed oligonucleotides (12 nM) were radiolabeled using terminal transferase andα 32P-ddATP (5000 Ci/mmol) (Amersham), as described by the manufacturer (Roche). Peptide concentrations and EMSA assay conditions were the same as described, with the exception that 6% polyacrylamide 0.5×TBE gels were used to resolve the protein-DNA complexes.
Sequences of the self-annealing oligonucleotides
BMP7C1,TTGACTGAGAGATAATGGGGTGGAAGGAGCCCCTCCTTCCACCCCATTATCTCTCAGTCAA;
BMP2C1,ATTTAGTTAATTGCAGGTTCAAGAAGCCCCTTCTTGAACCTGCAATTAACTAAAT;
BMP2C3,TTGTGTCTGTTAATATGCACATGAGCGAGCCCCTCGCTCATGTGCATATTAACAGACACAA; and
BMP2C4, CTTTTTAATTGGGAGTTAAGAAGCCCCTTCTTAACTCCCAATTAAAAAG.
Cell culture and luciferase assays
Luciferase plasmid constructs
DNA regions bound by the A13-DBD peptide were amplified from mouse genomic DNA by using PCR and the following primers:
BMP2, 5′-ATTTAGTTAATTGCAGGAAGGT-3′ and 5′-ACTCCCAATTAAAAAGAGCATT-3′; and
BMP7s1, 5′-GGAAGTGCAGAAGCACCC-3′ and 5′-ATGGTAATCACTCAGACCTAA-3′.
PCR conditions used a 2 minute soak at 94°C, followed by 35 cycles of 94°C, 54°C and 72°C for 30 seconds each step. Amplified PCR products were cloned in both orientations into the SmaI site of the pGL3 luciferase vector (Promega) to produce the pGL3BMP2FLuc, pGL3BMP2RLuc,pGL3BMP7FLuc and pGL3BMP7RLuc plasmids. The sequences and orientation of the cloned fragments were verified using di-deoxy terminator fluorescent sequencing.
Hoxa13-HA expression plasmid
The Hoxa13-HA expression plasmid (pCMV-A13) used in the luciferase and immunoprecipitation assays was produced using a 2-kb genomic region containing the murine Hoxa13 locus. An HA epitope tag was added to the 3′ end of the Hoxa13 coding region, using a unique SpeI restriction site to add the following annealed oligonucleotides:
5′-CTAGTGGAGGATACCCATACGACGTCCCAGACTACGCTTAAGATATCA-3′; and
5′-CTAGTGATATCTTAAGCGTAGTCTGGGACGTCGTATGGGTATCCTCCA-3′.
Cell culture and transfection
NG108-15 cells were grown as recommended by the supplier (ATCC). At 90%confluence, the cells were passaged into 12-well dishes (Costar), grown at 37°C, 10% CO2 for 24 hours, and then transfected with 2 μg of pGL3BMP2 or pGL3BMP7, 2 μg of pCMV-A13, or 2 μg of empty pCMV vector,and 0.5 μg of the pRL-CMV Renilla plasmid (Promega) to normalize for transfection efficiency. All transfections used the Superfect Reagent, as recommended by the manufacturer (Qiagen). Forty-eight hours after transfection, cells were rinsed with PBS, lyzed with M-Per lysis reagent(Pierce), and processed to detect luciferase activity using the Dual-Glo Luciferase Assay System (Promega). Luciferase activity was determined as the average of three separate readings of each well (1 second/read), using a Packard Fusion Universal Microplate Analyzer (Perkin Elmer). For each experimental condition four separate transfections were performed. Results were normalized for transfection efficiency using relative Renilla luciferase expression levels, as described by the manufacturer (Promega), and plotted using SigmaPlot 8.0 (SPSS).
Hoxa13 antibody production
A HOXA13 peptide, corresponding to amino acids 1-43 of the murine HOXA13(MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAA)(Mortlock and Innis, 1997) was used to immunize New Zealand White rabbits. Samples exhibiting high Hoxa13 antibody titers by ELISA were assessed for specificity to the full-length HOXA13, using western blot and immunohistochemistry of cultured limb mesenchyme derived from mice heterozygous for a temperature-sensitive T-antigen (Immorto® mice, Charles River Laboratories) and homozygous for the HOXA13-GFP mutant allele. A Cytological Nuclear Stain Kit (Molecular Probes) was used to label nuclei with DAPI.
Chromatin immunoprecipitation (ChIP)
ChIP assays were performed using a chromatin immunoprecipitation assay, as described (Upstate Biotechnology), with the following modifications: limb buds from E12.5 Hoxa13GFP wild-type and homozygous-mutant embryos were dissected in PBS containing 15 μl/ml protease inhibitor cocktail (PIC) (Sigma). Lysates were sonicated for four periods of 10 seconds at 4°C using a Microson (Misonix) sonicater at 15% output. To avoid sample heating, tubes were placed in an ice/EtOH bath for 5 seconds before and after each sonication. Cell lysates were pre-cleared with 80 μl Gammabind(Amersham) containing 40 μg/ml tRNA (Roche) in 10 mM Tris-HCl (pH 8), 1 mM EDTA (GBS). After pre-clearing, all centrifugation steps were performed at 100 g for 2 minutes. Fifteen microliters of Hoxa13antibody or control solution (PBS) were used at the immunoprecipitation step. For collection of Hoxa13 antibody/HOXA13/DNA complexes, 60 μl of GBS was added to the samples. The Gammabind/Hoxa13antibody/HOXA13/DNA complexes were washed twice for 5 minutes at 4°C for each wash step. DNA was eluted from the immune complexes by digesting overnight at 45°C in 50 mM Tris-HCl (pH 8.4), 1 mM EDTA, 0.5% Tween-20 containing 20 μg/ml Proteinase K (Invitrogen). Eluted DNA from the antibody or no antibody control samples were assessed for the presence of the Bmp2,Bmp7s1 or Bmp7s2 DNA regions using PCR and the primers described above. For Bmp7s2, the following primers were used to PCR amplify immunoprecipitated chromatin: 5′-GCCTCTGTTCTTGCTGCGCT-3′ and 5′-ACATGAACATGGGCGCCG-3′.
Results
Hoxa13 is expressed in discrete regions of the developing autopod
Examination of Hoxa13 expression in the developing autopods revealed a dynamic spatiotemporal pattern of expression in tissues critical for IPCD and digit chondrogenesis. At E12.5 Hoxa13 expression is localized to the distal autopod mesenchyme in both the digit condensations and interdigital tissues (data not shown)(Haack and Gruss, 1993). By E13.5 Hoxa13 expression transfers to the peridigital tissues and interarticular condensations (Fig. 1A), whereas in E14.5 forelimbs, Hoxa13 expression becomes restricted to the distal interarticular joint fields and nail beds(Fig. 1C). In homozygous mutants, the localization of Hoxa13 transcripts is consistently elevated at all gestational ages when compared with wild-type controls,suggesting either that HOXA13 may negatively regulate its own expression or that mutant Hoxa13-GFP transcripts turn over at a slower rate than wild-type Hoxa13 mRNA (Fig. 1B,D).
To correlate the sites of Hoxa13 localization with malformations present in Hoxa13 mutant limbs, we examined digit separation and development in E15.5 limbs. In these tissues, the loss of Hoxa13function resulted in severe malformations of the distal joints, as well as a persistence of the interdigital tissues(Fig. 1E,F)(Stadler et al., 2001; Fromental-Ramain et al.,1996a). Interestingly, the separation of digits II-V is effected in a highly reproducible pattern in Hoxa13 mutant forelimbs, where digits II-III and IV-V exhibit the greatest degree of soft-tissue fusion,whereas digits III-IV exhibit modest removal of the distal interdigital tissue(Fig. 1C-F).
Reduced Bmp2 and Bmp7 expression in Hoxa13mutant autopods
Recognizing that limbs lacking Hoxa13 exhibit severe defects in the initiation of IPCD and joint formation(Stadler et al., 2001)(Fig. 1), and that BMP2 and BMP7 function as key regulators of IPCD and digit chondrogenesis(Zuzarte-Luís and Hurlé,2002; Merino et al.,1998; Macias et al.,1997; Zou et al.,1997; Yokouchi et al.,1996; Zou and Niswander,1996), we examined their expression in Hoxa13 wild-type and mutant forelimbs. Analysis of Bmp7 expression in E12.5-13.5 wild-type embryos revealed high levels of expression in the interdigital tissues (Fig. 1G,I). By contrast, age-matched homozygous mutants exhibited a marked reduction in Bmp7 expression in the interdigital and peridigital regions,specifically in domains that co-express Hoxa13(Fig. 1H,J,S-V).
Bmp2 expression was also reduced in the interdigital tissues, the developing nail beds, and the distal joints of E12.5 and E14.5 homozygous mutants, which exhibited a diffuse distribution of Bmp2 transcripts when compared with wild-type controls (Fig. 1A,C,K-N). Next, to determine whether the loss of BMP signaling in Hoxa13 mutant limbs affects the expression of BMP-regulated genes, we examined Msx2 expression in the distal interdigital tissues. In Hoxa13 mutant limbs, Msx2 expression was noticeably reduced in the interdigital tissues when compared with wild-type controls at E12.5 and E13.5 (Fig. 1O-R).
To verify that BMP7 and HOXA13 proteins co-localize to the same cells in developing interdigital tissues, we examined BMP7 and HOXA13 protein distribution using a BMP7 antibody and the HOXA13-GFP fusion protein. In E12.5 autopods, HOXA13-GFP and BMP7 proteins co-localized to the same cells in the distal interdigital tissues of both heterozygous and homozygous mutants(Fig. 1S-V). However, the interdigital tissues of Hoxa13 homozygous mutants consistently exhibited fewer BMP7-positive cells, as predicted by the decreased levels of Bmp7 transcripts in this region(Fig. 1H,J). Co-localization of HOXA13-GFP and BMP2 proteins could not be determined by immunohistochemistry because commercially available BMP2 antibodies failed to detect BMP2 protein in autopod frozen sections at E12.5 or E13.5 (data not shown).
HOXA13 directly binds DNA regions upstream of Bmp2 and Bmp7
Because Bmp2, Bmp7 and Hoxa13 are co-expressed in the developing limb, and their expression is reduced in Hoxa13 mutants,we hypothesized that HOXA13 may directly regulate Bmp2 and Bmp7 expression in the distal autopod. To address this possibility, a HOXA13 DNA-binding domain peptide (A13-DBD) was used to screen DNA regions upstream of Bmp2 and Bmp7 for direct HOXA13 binding. Prior to this analysis, it was necessary to confirm that the putative DNA-binding domain present in the C terminus of HOXA13 actually folds into a DNA-binding structure and to determine the biophysical conditions that maintain proper folding for subsequent DNA-binding studies.
Characterization of the A13-DBD secondary structure by circular dichroic spectroscopy (CD) revealed the peptide stably folds into an α-helical structure, consistent with the predicted helix-turn-helix DNA-binding motif encoded by the A13-DBD peptide (Fig. 2A, left panel). The folded A13-DBD peptide also exhibited reasonable thermal stability, maintaining its α-helical structure between 4 and 25°C (Fig. 3A, right panel). At temperatures higher than 25°C, the A13-DBD peptide showed a cooperative transition to a denatured conformation(Fig. 2A, right panel),confirming that the majority of the A13-DBD peptide folds into the detectedα-helical motif. Based on this analysis, we performed our DNA-binding experiments at temperatures between 4 and 25°C in order to maintain A13-DBD secondary structure stability. By contrast, full-length HOXA13 could not be examined for proper folding and function, as the molecule prepared by in vitro translation was only soluble in a denatured state, preventing CD analysis, as well as its use as a DNA-binding molecule (data not shown).
To identify HOXA13 binding sites upstream of Bmp2 and Bmp7, the A13-DBD peptide was incubated with 200- to 400-base pair(bp) regions upstream of Bmp2 and Bmp7. In the presence of the A13-DBD peptide, strong DNA binding was detected within 600 bp of the Bmp2 initiation codon, whereas for Bmp7 an A13-DBD binding site was not detected until 3000 bp upstream of the initiation codon (data not shown). Using self-annealing oligonucleotides, the minimal DNA sequences bound by the A13-DBD peptide were identified(Fig. 2B). Within the Bmp2 upstream region, four A13-DBD binding sites, Bmp2 C1-C4, were identified. For the bound Bmp7 upstream region, a single A13-DBD binding site, Bmp7C1, was identified(Fig. 2B). Competition experiments revealed that the A13-DBD peptide exhibited specificity and differential affinity for each of the bound DNA sequences(Fig. 2B,C). For Bmp2,the A13-DBD peptide exhibited the highest affinity for regions C1 and C3,which required competitor DNA concentrations of between 300 and 750 nM to displace the bound radiolabeled probe. By contrast, the A13-DBD peptide exhibited less affinity for Bmp2 region C4, where 150 nM concentrations of competitor DNA were sufficient to completely displace the corresponding radiolabeled oligonucleotide(Fig. 2B). A fourth Bmp2 DNA region, Bmp2C2, was also bound by the A13-DBD peptide; however, 2- to 4-fold higher concentrations of A13-DBD were required to affect its electrophoretic mobility(Fig. 2C).
Analysis of the Bmp7C1 binding site revealed the highest A13-DBD affinity for any of the A13-DBD bound sequences, requiring competitor DNA concentrations of greater than 750 nM to completely displace the radiolabeled BMP7C1 oligonucleotide (Fig. 2B,E). The DNA-binding specificity of A13-DBD was confirmed using a randomized self-annealing oligonucleotide that exhibited no changes in electrophoretic mobility in the presence of 4-fold higher concentrations of A13-DBD peptide (Fig. 2D). Similarly, concentrations of control oligonucleotide greater than 750 nM could not displace the A13-DBD-bound Bmp7C1 oligonucleotide, confirming high affinity and specificity for the Bmp7C1 binding site(Fig. 2E).
Analysis of the DNA sequences bound by the A13-DBD peptide revealed a HOX-specific TAAT nucleotide core sequence(Fig. 2F). However the nucleotides flanking the TAAT site varied greatly from sequences bound by other HOX proteins, suggesting that HOXA13 may recognize unique DNA sequences to facilitate its tissue-specific regulation of gene expression(Catron et al., 1993; Pellerin et al., 1994). Interestingly, a second TAAT-containing region (Bmp7s2) was identified in the sequences upstream of Bmp7; however, in the presence of the A13-DBD peptide the Bmp7s2 sequence did not exhibit any change in electrophoretic mobility (data not shown), suggesting that nucleotides flanking the TAAT core sequence in Bmp7s1 confer binding specificity.
The Bmp2 and Bmp7 sequences bound by A13-DBD function as enhancers of gene expression in vitro
A 384 bp fragment containing the four Bmp2 binding sites(BMP2C1-C4) was cloned into a luciferase reporter plasmid and tested for in vitro transcriptional regulation by HOXA13. Cells transfected with the Bmp2 luciferase vector and the Hoxa13 expression plasmid(pCMV-A13) exhibited a consistent increase in relative luciferase activity(RLA) when compared with control transfections lacking pCMV-A13(Fig. 3A). Comparisons of forward and reverse orientations of the 384 bp upstream region revealed a 2.5-and 1.8-fold increase in RLA, suggesting that the 384 bp Bmp2 region functions as a HOXA13-regulated enhancer of gene expression(Fig. 3A,C). Similarly, a 216 bp fragment containing the BMP7C1-binding site also caused an increase in luciferase reporter expression, resulting in a 1.8- and 2.0-fold increase in RLA for the forward and reverse orientations, respectively(Fig. 3B,C). Our detection of direct interactions between A13-DBD and these enhancer elements, as well as the ability of these enhancer elements to drive reporter gene expression only in the presence of HOXA13 strongly supports our hypothesis that HOXA13 directly regulates the expression of Bmp2 and Bmp7 in the developing autopod.
HOXA13 associates with the Bmp2 and Bmp7 enhancer elements in the developing autopod
To verify that HOXA13 also binds the Bmp2 and Bmp7enhancer regions in vivo, a Hoxa13 antibody was developed to immunoprecipitate endogenous HOXA13-DNA complexes from limb bud chromatin. To identify both wild-type and mutant HOXA13 proteins, the Hoxa13antibody (αHoxa13) was raised against the N-terminal region of HOXA13,which is conserved in both wild-type and mutant protein isoforms. Analysis of the proteins recognized by αHoxa13 revealed two predominant bands by western blot hybridization whose sizes matched the predicted molecular weights of HOXA13 wild-type (43 kDa) and mutant proteins (64 kDa)(Fig. 3D). The ability ofαHoxa13 to immunoprecipitate native HOXA13 was confirmed by western blot analysis of precipitated cell lysates expressing full-length HOXA13 tagged with an HA epitope (Fig. 3E). In cultured limb mesenchyme, the Hoxa13 antibody co-localizes with endogenous HOXA13-GFP, confirming the specificity of the Hoxa13antibody (Fig. 3F-I).
Next, to verify that endogenous HOXA13 binds the same Bmp2 and Bmp7 enhancer elements in the developing limb, αHoxa13 was used to immunoprecipitate chromatin from wild-type and homozygous mutant limbs. In wild-type limbs, chromatin immunoprecipitated with αHoxa13 consistently contained the enhancer elements bearing the Bmp2C1, C3 and C4, and Bmp7s1 nucleotide sequences(Fig. 3J,K). By contrast,chromatin immunoprecipitations from Hoxa13 homozygous mutant limbs did not contain these same enhancer regions, which is consistent with the ablation of the DNA-binding domain in the Hoxa13GFP mutant allele (Stadler et al., 2001)(Fig. 3J,K).
To confirm the in vivo specificity of HOXA13 for the TAAT-containing sequences in the Bmp2 and Bmp7 enhancers, wild-typeαHoxa13 chromatin immunoprecipitates were also examined for the presence of the Bmp7s2 sequence, which contains a TAAT core sequence but is not bound by the A13-DBD peptide (data not shown). In all cases examined, the Bmp7s2 sequence could not be detected in wild-type chromatin immunoprecipitates, confirming the in vivo specificity of HOXA13 for the Bmp2 and Bmp7s1 sequences(Fig. 3L). These results strongly suggest that endogenous HOXA13 directly binds the Bmp2 and Bmp7 enhancer sequences, and that it is through these interactions that HOXA13 controls the expression of Bmp2 and Bmp7 in the distal limb.
Reduced Bmp2 and Bmp7 expression underlies the loss of IPCD in the Hoxa13 homozygous mutant limb
Recognizing that HOXA13 can regulate gene expression through the Bmp2 and Bmp7 enhancer elements in vitro(Fig. 3A-C), and that it associates with these enhancer sites in the developing limb(Fig. 3J,K), we hypothesized that the limb phenotypes exhibited by Hoxa13 homozygous mutants must be due, in part, to insufficient levels of BMP2 and BMP7. Testing this hypothesis, we examined whether increasing the levels of BMP2 or BMP7 in Hoxa13 mutant autopods could rescue some aspects of the interdigital or interarticular joint phenotypes. For the interarticular malformations,supplementation of the autopod tissues with BMP2- or BMP7-treated beads could not restore the normal formation of the joint regions(Fig. 1E,F; data not shown). By contrast, supplementation of the interdigital tissues with either BMP2- or BMP7-treated beads restored distal IPCD in Hoxa13 homozygous mutants,whereas control experiments using PBS-treated beads did not affect the levels of IPCD in either homozygous mutant or heterozygous control limbs(Fig. 4A-F). These results suggest that BMP insufficiency may underlie the loss of IPCD in Hoxa13 mutant limbs.
However, although exogenous BMP2 or BMP7 can reinitiate IPCD in Hoxa13 mutant limbs, the levels of IPCD were never equivalent to identical treatments in Hoxa13 heterozygous limbs (compare Fig. 4A with 4D, and 4B with 4E). This result suggests that the competency of the interdigital tissues to fully respond to BMP signals may also be affected in Hoxa13 mutant limbs. To test this possibility, we examined whether exogenous treatments with BMP2 or BMP7 induced Msx2 expression to different degrees in wild-type versus mutant limbs. Exogenous applications of BMP2 or BMP7 induced Msx2 expression in the tissue immediately surrounding the implanted beads in Hoxa13 mutant and wild-type limbs,whereas treatments with beads soaked in PBS did not induce Msx2expression (Fig. 4G-L). For both BMP2 and BMP7 treatments, the level of Msx2 induction was consistently lower in the homozygous mutant limbs(Fig. 4H,J), confirming that the interdigital tissues of Hoxa13 mutants lack the competency to fully transduce BMP signals. This finding suggests that additional components in the BMP-signaling pathway may be affected by loss of HOXA13 function,although no differences in the expression of BMP-receptors Ia, Ib or II were detected between wild-type and Hoxa13 mutant limbs at E12.5-13.5 (data not shown).
IPCD is delayed in Bmp7 mutant mice
TUNEL analysis of Bmp7 mutant limbs at E13.5 revealed a significant delay in IPCD between digits II and III(Fig. 5A-D), which is the same interdigital region lacking IPCD in Hoxa13 homozygous mutants(Stadler et al., 2001). This result suggests that reductions in BMP7 in Hoxa13 mutant limbs can affect IPCD initiation, particularly in tissues where responsiveness to BMP signals is also reduced. For the region between digits III and IV,TUNEL-positive cells were detected at slightly elevated levels in Bmp7 mutants, suggesting that BMP7 may regulate IPCD in a differential manner between digits II and III, versus digits III and IV.
HOXA13 functions upstream of Bmp2 and Bmp7 in the developing autopod
Previous investigations of BMP function indicate that BMP2 can induce Hoxa13 expression to control forelimb muscle patterning(Hashimoto et al., 1999). This result led us to examine whether BMP2 or BMP7 may function in a similar manner in the developing mouse autopod. In all cases examined (4/4), supplementation of the interdigital tissues with BMP2 or BMP7 did not induce Hoxa13expression (Fig. 5E-G). Furthermore, the elevated levels of Hoxa13 mRNA in Hoxa13mutant autopods (see Fig. 1B,D)supports the conclusion that Hoxa13 expression is independent of BMP2 and BMP7, as these same tissues exhibit reduced levels of Bmp2 and Bmp7 expression (see Fig. 1H,J,L,N).
Discussion
Hoxa13, Bmp2 and Bmp7 are co-expressed in the developing autopod mesenchyme
The initial finding of this study is that Hoxa13 is expressed in specific spatiotemporal domains coincident with Bmp2 and Bmp7 expression during embryonic limb development. Further characterization of these expression patterns in Hoxa13 mutant limbs identified a loss of Bmp2 and Bmp7 expression in the distal limb mesenchyme, consistent with the severe defects in IPCD and chondrogenesis exhibited by mutant autopods in these same regions. This characterization places Hoxa13, Bmp2 and Bmp7 in the same tissues at the same time during normal limb development, and identifies Bmp2 and Bmp7 as being reduced in the absence of functional HOXA13.
Hoxa13 coordinates BMP signaling during distal limb development
In the present study one of our major conclusions is that HOXA13 directly regulates the expression of both Bmp2 and Bmp7 in the distal autopod. In the absence of HOXA13 function, the interdigital tissues also exhibit reduced responsiveness to BMP-induced programmed cell death. Together these results suggest that HOXA13 functions at multiple levels of the BMP-signaling pathway to direct IPCD and distal digit development. The function of HOX proteins to regulate multiple steps in a developmental pathway is well described in Drosophila where Ubx function is required to regulate multiple genes during the specification of wing and haltere structures (Weatherbee et al.,1998). Studies of BMP-receptor function support the conclusion that HOXA13 regulates BMP-signaling to control digit chondrogenesis, as mice lacking BMPR-IB in the distal limb exhibit defects in chondrogenesis remarkably similar to Hoxa13 mutants(Stadler et al., 2001; Baur et al., 2000; Yokouchi et al., 1995). Similarly, the expression of dominant-negative isoforms of BMPR-IB in chick also affect IPCD, as well as the chondrogenic capacity of the distal limb mesenchyme, phenotypes both described in Hoxa13 mutant limb mesenchyme (Zou and Niswander,1996; Zou et al.,1997; Stadler et al.,2001).
In mice, the function of BMP2 during distal limb development is unknown as Bmp2 homozygous mutants fail to develop to the limb bud stage(Zhang and Bradley, 1996). In Bmp7 homozygous mutants, the predominant limb phenotype is the addition of an extra anterior digit, whereas the interdigital tissues are completely resolved (Dudley et al.,1995; Luo et al.,1995; Hofmann et al.,1996). The resolution of the interdigital tissues in Bmp7mutant mice has been explained by compensatory BMPs co-expressed in these same tissues (Francis-West et al.,1999; Dudley and Robertson,1997; Dudley et al.,1995; Luo et al.,1995; Lyons et al.,1995; Francis et al.,1994; Hogan et al.,1994; Kingsley,1994; Lyons et al.,1989). In the limb, IPCD can be stimulated by BMP2, BMP4 and BMP7(Guha et al., 2002; Merino et al., 1999a; Gañan et al., 1996; Yokouchi et al., 1996). However, in Bmp7 mutants, the delay in IPCD at E13.5 provides strong evidence that compensatory factors, such as BMP2 and BMP4, do not use the same BMP-signaling components as BMP7, suggesting that additional factors like bioavailability, oligomerization or receptor utilization may also regulate the timing of IPCD (Keller et al.,2004; Groppe et al.,2002; Nohe et al.,2002; Bosukonda et al.,2000; Capdevila and Johnson,1998; Zou et al.,1997; Zou and Niswander,1996; Lyons et al.,1995). Thus, in Hoxa13 homozygous mutants, two compounding events contribute to the loss of IPCD. First, BMP2 and BMP7 are reduced in the mutant interdigital tissues to levels below the threshold necessary for IPCD initiation. Second, the competency of the interdigital tissues to respond to BMP signals is affected by loss of Hoxa13function.
Surprisingly, mice heterozygous for both Bmp2 and Bmp7(Bmp2/7) do not exhibit any defects in limb development(Katagiri et al., 1998). This result is most likely explained by compensatory levels of additional BMPs or the upregulation of BMP2, BMP7, or their receptors in Bmp2/7compound heterozygotes, which to date have not been determined in these mice. Clearly, conditional mutants producing combinatorial losses of redundant BMP proteins will be required to define the functions of these growth factors during distal limb development, particularly in regions where BMPs regulate both digit chondrogenesis and IPCD. Interestingly, the differential use of BMPs to direct digit chondrogenesis may also affect IPCD, as apoptosis in limb mesenchyme is directly linked to the level of chondrogenesis(Omi et al., 2000; Merino et al., 1999b). This finding is consistent with the differential IPCD in Hoxa13 mutant limbs, where digits II and III exhibit the least amount of chondrogenesis and IPCD (Fig. 1D-F).
Isolation of HOXA13-Bmp2 and -Bmp7 enhancer complexes in the developing autopod defines these genes as direct targets of HOXA13 regulation
Using a biochemical approach, we confirmed the C-terminal region of HOXA13 folds into a functional DNA-binding motif and binds DNA in a sequence-specific manner. In vitro, the A13-DBD peptide facilitated the identification of HOXA13-binding sites upstream of Bmp2 and Bmp7. Quantitation of A13-DBD affinity for these enhancer elements revealed a novel series of nucleotide sequences that are preferentially bound with affinities almost 2-fold greater than the DNA regions bound by other homeodomain peptides(Catron et al., 1993).
In vivo, the interactions between HOXA13 and the Bmp2 and Bmp7 enhancer regions are conserved, as both enhancer elements were present in immunoprecipitated complexes of HOXA13 bound to DNA. The association of HOXA13 with the Bmp2 and Bmp7 enhancer regions in the developing limb strongly suggests that HOXA13 directly regulates the expression of these genes during autopod formation. It is important to note that because chromatin immunoprecipitations do not separate protein complexes prior to immunoprecipitation, we cannot exclude the possibility that HOXA13 interacts with the Bmp2 and Bmp7enhancer regions as part of a protein complex. However, this possibility seems unlikely because of the absence of the Bmp2 and Bmp7enhancer regions in immunoprecipitations using Hoxa13 mutant limbs that lack the HOXA13 DNA-binding domain, and because of the utilization of these enhancers by full-length HOXA13 to direct gene expression in vitro. In addition, the specificity of HOXA13 DNA-binding is confirmed by the presence of an additional TAAT-containing sequence upstream of Bmp7 that is not bound by either the A13-DBD peptide (data not shown) or the full-length endogenous HOXA13, as determined by chromatin immunoprecipitation from wild-type autopods (Fig. 3L). This finding confirms that the nucleotides flanking the core TAAT sequence are crucial for HOXA13 binding, supporting our hypothesis that HOXA13 interacts with specific DNA sequences to facilitate its tissue-specific regulation of gene expression (Catron et al.,1993; Pellerin et al.,1994).
Previous investigations of HOXA13 function indicate that Bmp4expression may also be regulated by HOXA13 DNA-binding(Suzuki et al., 2003). However, by our analysis, the expression of Bmp4 appears to be normal in Hoxa13 mutant limbs (data not shown), suggesting that the cooperative regulation of Bmp4 by SP1 may compensate for the loss of HOXA13 DNA-binding function. This finding is consistent with the absence of the Bmp4 sequence in the wild-type limb chromatin immunoprecipitated with a Hoxa13 antibody (data not shown). In the N terminus of HOXA13,protein-protein interactions may also facilitate some aspects of its function,as mutations expanding the number of N-terminal polyalanine residues cause defects in limb and genitourinary development that are similar to those resulting from mutations ablating the HOXA13 DNA-binding domain(Goodman et al., 2000; Mortlock and Innis, 1997).
In this paper, we present the first evidence that during limb development HOXA13 directly interacts with gene-regulatory elements upstream of Bmp2 and Bmp7. In vivo, the loss of HOXA13 DNA-binding function abolishes interactions with these enhancer elements and reduces the expression of Bmp2 and Bmp7 in the developing autopod,causing defects that phenocopy malformations associated with perturbations in BMP signaling. Together, these findings strongly suggest that HOXA13 controls the morphogenesis of discrete autopod tissues by regulating Bmp2 and Bmp7 expression through direct interactions with Bmp2 and Bmp7 enhancer elements, confirming our hypothesis that the phenotypes exhibited by Hoxa13 mutant mice reflect a loss in the tissue-specific regulation of direct target genes.
Acknowledgements
The authors thank Dr Brigid Hogan for the critical reading of this manuscript. This work was supported by research grants from the Shriners Hospital for Children and the National Institutes of Health (H.S.S.), and by a NIH pre-doctoral fellowship (W.M.K.).